Lineage for d1s64i_ (1s64 I:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775631Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 775632Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 775633Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 775680Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
    Uniprot Q04631 55-369
  8. 775703Domain d1s64i_: 1s64 I: [105295]
    Other proteins in same PDB: d1s64b_, d1s64d_, d1s64f_, d1s64h_, d1s64j_, d1s64l_

Details for d1s64i_

PDB Entry: 1s64 (more details), 2.55 Å

PDB Description: Rat protein geranylgeranyltransferase type-I complexed with L-778,123 and a sulfate anion
PDB Compounds: (I:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOP Domain Sequences for d1s64i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s64i_ a.118.6.1 (I:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1s64i_:

Click to download the PDB-style file with coordinates for d1s64i_.
(The format of our PDB-style files is described here.)

Timeline for d1s64i_: