Lineage for d1s64i_ (1s64 I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726313Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2726314Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2726329Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2726355Domain d1s64i_: 1s64 I: [105295]
    Other proteins in same PDB: d1s64b_, d1s64d_, d1s64f_, d1s64h_, d1s64j_, d1s64l_
    complexed with 778, cl, mes, so4, zn

Details for d1s64i_

PDB Entry: 1s64 (more details), 2.55 Å

PDB Description: Rat protein geranylgeranyltransferase type-I complexed with L-778,123 and a sulfate anion
PDB Compounds: (I:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1s64i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s64i_ a.118.6.1 (I:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1s64i_:

Click to download the PDB-style file with coordinates for d1s64i_.
(The format of our PDB-style files is described here.)

Timeline for d1s64i_: