Lineage for d1s64g_ (1s64 G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647144Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 647145Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 647146Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 647193Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (27 PDB entries)
  8. 647214Domain d1s64g_: 1s64 G: [105293]
    Other proteins in same PDB: d1s64b_, d1s64d_, d1s64f_, d1s64h_, d1s64j_, d1s64l_

Details for d1s64g_

PDB Entry: 1s64 (more details), 2.55 Å

PDB Description: Rat protein geranylgeranyltransferase type-I complexed with L-778,123 and a sulfate anion
PDB Compounds: (G:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOP Domain Sequences for d1s64g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s64g_ a.118.6.1 (G:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1s64g_:

Click to download the PDB-style file with coordinates for d1s64g_.
(The format of our PDB-style files is described here.)

Timeline for d1s64g_: