Lineage for d1s64b_ (1s64 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722636Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2722637Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2722652Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2722674Domain d1s64b_: 1s64 B: [105288]
    Other proteins in same PDB: d1s64a_, d1s64c_, d1s64e_, d1s64g_, d1s64i_, d1s64k_
    complexed with 778, cl, mes, so4, zn

Details for d1s64b_

PDB Entry: 1s64 (more details), 2.55 Å

PDB Description: Rat protein geranylgeranyltransferase type-I complexed with L-778,123 and a sulfate anion
PDB Compounds: (B:) Geranylgeranyl transferase type I beta subunit

SCOPe Domain Sequences for d1s64b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s64b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1s64b_:

Click to download the PDB-style file with coordinates for d1s64b_.
(The format of our PDB-style files is described here.)

Timeline for d1s64b_: