Lineage for d1s63a_ (1s63 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007074Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2007075Family a.118.6.1: Protein prenylyltransferase [48440] (3 protein domains)
  6. 2007076Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2007077Species Human (Homo sapiens) [TaxId:9606] [69093] (13 PDB entries)
    Uniprot P49354
  8. 2007084Domain d1s63a_: 1s63 A: [105285]
    Other proteins in same PDB: d1s63b_
    complexed with 778, fpp, suc, zn

Details for d1s63a_

PDB Entry: 1s63 (more details), 1.9 Å

PDB Description: Human protein farnesyltransferase complexed with L-778,123 and FPP
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1s63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s63a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhst

SCOPe Domain Coordinates for d1s63a_:

Click to download the PDB-style file with coordinates for d1s63a_.
(The format of our PDB-style files is described here.)

Timeline for d1s63a_: