Lineage for d1s60a1 (1s60 A:1-145)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (2 species)
  7. Species Salmonella enteritidis [TaxId:149539] [111099] (3 PDB entries)
    Uniprot Q9R381
  8. Domain d1s60a1: 1s60 A:1-145 [105282]
    Other proteins in same PDB: d1s60a2
    complexed with coa, so4

Details for d1s60a1

PDB Entry: 1s60 (more details), 3 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and N-terminal His(6)-tag (crystal form 2)
PDB Compounds: (A:) aminoglycoside 6'-N-acetyltransferase

SCOPe Domain Sequences for d1s60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s60a1 d.108.1.1 (A:1-145) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}
mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
tisqkvhqalgfeetervifyrkrc

SCOPe Domain Coordinates for d1s60a1 are not available.

Timeline for d1s60a1:

Domains from same chain:
(mouse over for more information)
d1s60a2