SCOPe 2.07: Domain d1s5rb_: 1s5r B:

Lineage for d1s5rb_ (1s5r B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.59: PAH2 domain [47761] (1 superfamily)
   4 helices; open up-and-down bundle; binds alpha-helical peptides

4. Superfamily a.59.1: PAH2 domain [47762] (1 family)

5. Family a.59.1.1: PAH2 domain [47763] (3 proteins)

6. Protein Sin3A [47766] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47767] (5 PDB entries)
   Uniprot Q96ST3 295-383

8. Domain d1s5rb_: 1s5r B: [105281]
   Other proteins in same PDB: d1s5ra_

Details for d1s5rb_

PDB Entry: 1s5r

PDB Description: solution structure of hbp1 sid-msin3a pah2 complex

PDB Compounds: (B:) Sin3a protein

SCOPe Domain Sequences for d1s5rb_:

Sequence; same for both SEQRES and ATOM records:

>d1s5rb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]}
slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
eqevyaqvarlfknqedllsefgqflpda

Timeline for d1s5rb_:

• d1s5rb_ first appeared in SCOP 1.69
  
• d1s5rb_ appears in SCOPe 2.06
  
• d1s5rb_ appears in the current release, SCOPe 2.08