Lineage for d1s5rb_ (1s5r B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444222Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 444223Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 444224Family a.59.1.1: PAH2 domain [47763] (2 proteins)
  6. 444225Protein Sin3A [47766] (1 species)
  7. 444226Species Mouse (Mus musculus) [TaxId:10090] [47767] (3 PDB entries)
  8. 444228Domain d1s5rb_: 1s5r B: [105281]
    Other proteins in same PDB: d1s5ra_

Details for d1s5rb_

PDB Entry: 1s5r (more details)

PDB Description: solution structure of hbp1 sid-msin3a pah2 complex

SCOP Domain Sequences for d1s5rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5rb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus)}
slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
eqevyaqvarlfknqedllsefgqflpda

SCOP Domain Coordinates for d1s5rb_:

Click to download the PDB-style file with coordinates for d1s5rb_.
(The format of our PDB-style files is described here.)

Timeline for d1s5rb_:

444228
d1s5rb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1s5ra_