Lineage for d1s5kb_ (1s5k B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609081Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609082Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 609083Family d.108.1.1: N-acetyl transferase, NAT [55730] (25 proteins)
  6. 609105Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (1 species)
  7. 609106Species Salmonella enteritidis [111099] (3 PDB entries)
  8. 609110Domain d1s5kb_: 1s5k B: [105277]
    complexed with coa, so4

Details for d1s5kb_

PDB Entry: 1s5k (more details), 2.4 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and N-terminal His(6)-tag (crystal form 1)

SCOP Domain Sequences for d1s5kb_:

Sequence, based on SEQRES records: (download)

>d1s5kb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis}
dirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfadas
irhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspent
isqkvhqalgfeetervifyrkrc

Sequence, based on observed residues (ATOM records): (download)

>d1s5kb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis}
dirqmnkthlehwrglrkqladgeeilqadhlasfiamadgvaigfadasirhdyvngcd
sspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspentisqkvhqalg
feetervifyrkrc

SCOP Domain Coordinates for d1s5kb_:

Click to download the PDB-style file with coordinates for d1s5kb_.
(The format of our PDB-style files is described here.)

Timeline for d1s5kb_: