Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d1s5il2: 1s5i L:108-214 [105275] Other proteins in same PDB: d1s5ih1, d1s5ih2, d1s5il1 |
PDB Entry: 1s5i (more details), 2.7 Å
SCOP Domain Sequences for d1s5il2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5il2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1s5il2: