SCOP 1.73: Domain d1s5il1: 1s5i L:1-107

Lineage for d1s5il1 (1s5i L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1s5il1: 1s5i L:1-107 [105274]
   Other proteins in same PDB: d1s5ih1, d1s5ih2, d1s5il2
   MQ P06310 P01837

Details for d1s5il1

PDB Entry: 1s5i, 2.7 Å

PDB Description: fab (lnkb-2) of monoclonal antibody to human interleukin-2, crystal structure

PDB Compounds: (L:) Fab-fragment of monoclonal antibody

SCOP Domain Sequences for d1s5il1:

Sequence; same for both SEQRES and ATOM records:

>d1s5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleik

Timeline for d1s5il1:

• d1s5il1 first appeared in SCOP 1.69
  
• d1s5il1 appears in SCOP 1.71
  
• d1s5il1 appears in SCOP 1.75
  
• d1s5il1 appears in the current release, SCOPe 2.08