Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (2 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d1s5hc_: 1s5h C: [105271] Other proteins in same PDB: d1s5ha1, d1s5ha2, d1s5hb1, d1s5hb2 complexed with dga, f09, k; mutant |
PDB Entry: 1s5h (more details), 2.2 Å
SCOPe Domain Sequences for d1s5hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5hc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatcvgygdl ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d1s5hc_:
View in 3D Domains from other chains: (mouse over for more information) d1s5ha1, d1s5ha2, d1s5hb1, d1s5hb2 |