SCOP 1.71: Domain d1s5hc_: 1s5h C:

Lineage for d1s5hc_ (1s5h C:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces coelicolor and Streptomyces lividans [56902] (13 PDB entries)

8. Domain d1s5hc_: 1s5h C: [105271]
   Other proteins in same PDB: d1s5ha1, d1s5ha2, d1s5hb1, d1s5hb2
   complexed with dga, f09, k; mutant

Details for d1s5hc_

PDB Entry: 1s5h, 2.2 Å

PDB Description: potassium channel kcsa-fab complex t75c mutant in k+

SCOP Domain Sequences for d1s5hc_:

Sequence; same for both SEQRES and ATOM records:

>d1s5hc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor and Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatcvgygdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1s5hc_:

• d1s5hc_ first appeared in SCOP 1.69
  
• d1s5hc_ appears in SCOP 1.73
  
• d1s5hc_ appears in the current release, SCOPe 2.08