SCOP 1.73: Domain d1s5gz_: 1s5g Z:

Lineage for d1s5gz_ (1s5g Z:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries)

8. Domain d1s5gz_: 1s5g Z: [105266]
   Other proteins in same PDB: d1s5ga1, d1s5ga2, d1s5gy_
   complexed with adp, ca, mg, so4

Details for d1s5gz_

PDB Entry: 1s5g, 3.1 Å

PDB Description: Structure of Scallop myosin S1 reveals a novel nucleotide conformation

PDB Compounds: (Z:) myosin essential light chain, striated adductor muscle

SCOP Domain Sequences for d1s5gz_:

Sequence; same for both SEQRES and ATOM records:

>d1s5gz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypd

Timeline for d1s5gz_:

• d1s5gz_ first appeared in SCOP 1.69
  
• d1s5gz_ appears in SCOP 1.71
  
• d1s5gz_ appears in SCOP 1.75
  
• d1s5gz_ appears in the current release, SCOPe 2.08