![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Myosin Essential Chain [47524] (3 species) |
![]() | Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries) Uniprot P13543 |
![]() | Domain d1s5gy_: 1s5g Y: [105265] Other proteins in same PDB: d1s5ga1, d1s5ga2, d1s5gz_ complexed with adp, ca, mg, so4 |
PDB Entry: 1s5g (more details), 3.1 Å
SCOPe Domain Sequences for d1s5gy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5gy_ a.39.1.5 (Y:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea pveggkfdyvkftamikgsgee
Timeline for d1s5gy_: