Lineage for d1s5gy_ (1s5g Y:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711040Protein Myosin Essential Chain [47524] (3 species)
  7. 2711041Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
    Uniprot P13543
  8. 2711047Domain d1s5gy_: 1s5g Y: [105265]
    Other proteins in same PDB: d1s5ga1, d1s5ga2, d1s5gz_
    complexed with adp, ca, mg, so4

Details for d1s5gy_

PDB Entry: 1s5g (more details), 3.1 Å

PDB Description: Structure of Scallop myosin S1 reveals a novel nucleotide conformation
PDB Compounds: (Y:) myosin regulatory light chain, striated adductor muscle

SCOPe Domain Sequences for d1s5gy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5gy_ a.39.1.5 (Y:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgsgee

SCOPe Domain Coordinates for d1s5gy_:

Click to download the PDB-style file with coordinates for d1s5gy_.
(The format of our PDB-style files is described here.)

Timeline for d1s5gy_: