Lineage for d1s5ga2 (1s5g A:3-28,A:77-836)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484603Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 484650Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 484651Species Bay scallop (Aequipecten irradians) [TaxId:31199] [52644] (11 PDB entries)
  8. 484656Domain d1s5ga2: 1s5g A:3-28,A:77-836 [105264]
    Other proteins in same PDB: d1s5ga1, d1s5gy_, d1s5gz_

Details for d1s5ga2

PDB Entry: 1s5g (more details), 3.1 Å

PDB Description: Structure of Scallop myosin S1 reveals a novel nucleotide conformation

SCOP Domain Sequences for d1s5ga2:

Sequence, based on SEQRES records: (download)

>d1s5ga2 c.37.1.9 (A:3-28,A:77-836) Myosin S1, motor domain {Bay scallop (Aequipecten irradians)}
idfsdpdfqylavdrkklmkeqtaafXmnppkfekledmanmtylneasvlynlrsryts
gliytysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdren
qsclitgesgagktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleay
gnakttrnnnssrfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqic
snaipelndvmlvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmf
kctasilhmgemkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtem
vtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdf
nsfeqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgi
lsileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpy
sitgwleknkdpinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavh
reslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfps
rliysefkqrysilapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgn
leemrderlskiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwkl
yskvkpl

Sequence, based on observed residues (ATOM records): (download)

>d1s5ga2 c.37.1.9 (A:3-28,A:77-836) Myosin S1, motor domain {Bay scallop (Aequipecten irradians)}
idfsdpdfqylavdrkklmkfXmnppkfekledmanmtylneasvlynlrsrytsgliyt
ysglfciavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqscli
tgesgagktentkkvimylakvacavegsledqiiqanpvleaygnakttrnnnssrfgk
firihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpd
sglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkq
rpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvga
lakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlq
qffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddk
sfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinen
vvallgaskeplvaelfkapeqtisavhreslnklmknlysthphfvrciipnelkqpgl
vdaelvlhqlqcngvlegiricrkgfpsrliysefkqrysilapnaipqgfvdgktvsek
ilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiismfqahirgylirkaykkl
qdqriglsviqrnirkwlvlrnwqwwklyskvkpl

SCOP Domain Coordinates for d1s5ga2:

Click to download the PDB-style file with coordinates for d1s5ga2.
(The format of our PDB-style files is described here.)

Timeline for d1s5ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s5ga1