Lineage for d1s58a_ (1s58 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472284Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 472761Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 472780Family b.121.5.2: Parvoviridae-like VP [88646] (2 proteins)
  6. 472784Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. 472799Species Human parvovirus B19 [TaxId:10798] [110116] (1 PDB entry)
  8. 472800Domain d1s58a_: 1s58 A: [105262]

Details for d1s58a_

PDB Entry: 1s58 (more details), 3.5 Å

PDB Description: The structure of B19 parvovirus capsid

SCOP Domain Sequences for d1s58a_:

Sequence, based on SEQRES records: (download)

>d1s58a_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Human parvovirus B19}
npvksmwsegatfsansvtctfsrqflipydpehhykvfspaasschnasgkeakvctit
pimgystpwryldfnalnlffsplefqhlienygsiapdaltvtiseiavkdvtdktggg
vqvtdsatgrlcmlvdheykypyvlgqgqdtlapelpiwvyfppqyayltvgdvntqgis
gdskklaseesafyvlehssfqllgtggtatmsykfppvppenlegcsqhfyemynplyg
srlgvpdtlggdpkfrslthedhaiqpqnfmpgplvnsvstkegdssntgagkaltglst
gtsqntrislrpgpvsqpyhhwdtdkyvtginaishgqttygnaedkeyqqgvgrfpnek
eqlkqlqglnmhtyfpnkgtqqytdqierplmvgsvwnrralhyesqlwskipnlddsfk
tqfaalggwglhqpppqiflkilpqsgpiggiksmgittlvqyavgimtvtmtfklgprk
atgrwnpqpgvypphaaghlpyvlydptatdakqhhrhgyekpeelwtaksrvhpl

Sequence, based on observed residues (ATOM records): (download)

>d1s58a_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Human parvovirus B19}
npvksmwsegatfsansvtctfsrqflipydpehhykvfspaasschnasgkeakvctit
pimgystpwryldfnalnlffsplefqhlienygsiapdaltvtiseiavkdvtdktggg
vqvtdsatgrlcmlvdheykypyvlgqgqdtlapelpiwvyfppqyayltvgdvntqgis
gdskklaseesafyvlehssfqllgtggtatmsykfppvppenlegcsqhfyemynplyg
srlgvpdtlggdpkfrslthedhaiqpqnfmpgplvnsvstktglstgtsqntrislrpg
pvsqpyhhwdtdkyvtginaishgqttygnaedkeyqqgvgrfpnekeqlkqlqglnmht
yfpnkgtqqytdqierplmvgsvwnrralhyesqlwskipnlddsfktqfaalggwglhq
pppqiflkilpqsgpiggiksmgittlvqyavgimtvtmtfklgprkatgrwnpqpgvyp
phaaghlpyvlydptatdakqhhrhgyekpeelwtaksrvhpl

SCOP Domain Coordinates for d1s58a_:

Click to download the PDB-style file with coordinates for d1s58a_.
(The format of our PDB-style files is described here.)

Timeline for d1s58a_: