Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries) Uniprot Q10784 |
Domain d1s56b_: 1s56 B: [105261] complexed with cyn, hec, hem, k, po4, xe |
PDB Entry: 1s56 (more details), 2.43 Å
SCOPe Domain Sequences for d1s56b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s56b_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]} gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap lavdvtsgesttapv
Timeline for d1s56b_: