Lineage for d1s56b_ (1s56 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976412Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1976413Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1976422Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. 1976438Domain d1s56b_: 1s56 B: [105261]
    complexed with cyn, hec, hem, k, po4, xe

Details for d1s56b_

PDB Entry: 1s56 (more details), 2.43 Å

PDB Description: Crystal Structure of "Truncated" Hemoglobin N (HbN) from Mycobacterium tuberculosis, Soaked with Xe Atoms
PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1s56b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s56b_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsgesttapv

SCOPe Domain Coordinates for d1s56b_:

Click to download the PDB-style file with coordinates for d1s56b_.
(The format of our PDB-style files is described here.)

Timeline for d1s56b_: