SCOPe 2.08: Domain d1s56a_: 1s56 A:

Lineage for d1s56a_ (1s56 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
   Uniprot Q10784

8. Domain d1s56a_: 1s56 A: [105260]
   complexed with cyn, hec, hem, k, po4, xe

Details for d1s56a_

PDB Entry: 1s56, 2.43 Å

PDB Description: Crystal Structure of "Truncated" Hemoglobin N (HbN) from Mycobacterium tuberculosis, Soaked with Xe Atoms

PDB Compounds: (A:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1s56a_:

Sequence; same for both SEQRES and ATOM records:

>d1s56a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

Timeline for d1s56a_:

• d1s56a_ first appeared in SCOP 1.69
  
• d1s56a_ appears in SCOPe 2.07