![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.6: YdiL-like [109813] (2 proteins) contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA |
![]() | Protein Putative cytoplasmic protein YdiL [109814] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [109815] (1 PDB entry) Uniprot Q8ZPR1 |
![]() | Domain d1s4kb_: 1s4k B: [105255] Structural genomics target |
PDB Entry: 1s4k (more details), 1.9 Å
SCOPe Domain Sequences for d1s4kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4kb_ a.35.1.6 (B:) Putative cytoplasmic protein YdiL {Salmonella typhimurium [TaxId: 90371]} ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc
Timeline for d1s4kb_: