Lineage for d1s4kb_ (1s4k B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442266Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 442267Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) (S)
  5. 442430Family a.35.1.6: YdiL-like [109813] (1 protein)
    contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA
  6. 442431Protein Putative cytoplasmic protein YdiL [109814] (1 species)
  7. 442432Species Salmonella typhimurium [TaxId:90371] [109815] (1 PDB entry)
  8. 442434Domain d1s4kb_: 1s4k B: [105255]
    Structural genomics target

Details for d1s4kb_

PDB Entry: 1s4k (more details), 1.9 Å

PDB Description: Putative cytoplasmic protein from Salmonella typhimurium

SCOP Domain Sequences for d1s4kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4kb_ a.35.1.6 (B:) Putative cytoplasmic protein YdiL {Salmonella typhimurium}
ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr
qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc

SCOP Domain Coordinates for d1s4kb_:

Click to download the PDB-style file with coordinates for d1s4kb_.
(The format of our PDB-style files is described here.)

Timeline for d1s4kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s4ka_