Lineage for d1s4kb1 (1s4k B:1-119)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993669Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1993670Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1994017Family a.35.1.6: YdiL-like [109813] (2 protein domains)
    contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA
  6. 1994024Protein Putative cytoplasmic protein YdiL [109814] (1 species)
  7. 1994025Species Salmonella typhimurium [TaxId:90371] [109815] (1 PDB entry)
    Uniprot Q8ZPR1
  8. 1994027Domain d1s4kb1: 1s4k B:1-119 [105255]
    Other proteins in same PDB: d1s4ka2, d1s4kb2
    Structural genomics target

Details for d1s4kb1

PDB Entry: 1s4k (more details), 1.9 Å

PDB Description: Putative cytoplasmic protein from Salmonella typhimurium
PDB Compounds: (B:) putative cytoplasmic protein ydil

SCOPe Domain Sequences for d1s4kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4kb1 a.35.1.6 (B:1-119) Putative cytoplasmic protein YdiL {Salmonella typhimurium [TaxId: 90371]}
mmnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarrq
rrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc

SCOPe Domain Coordinates for d1s4kb1:

Click to download the PDB-style file with coordinates for d1s4kb1.
(The format of our PDB-style files is described here.)

Timeline for d1s4kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s4kb2