SCOPe 2.01: Domain d1s4ka_: 1s4k A:

Lineage for d1s4ka_ (1s4k A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.6: YdiL-like [109813] (2 proteins)
   contains extra C-terminal all-alpha dimerization subdomain; the dimer may bind DNA

6. Protein Putative cytoplasmic protein YdiL [109814] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [109815] (1 PDB entry)
   Uniprot Q8ZPR1

8. Domain d1s4ka_: 1s4k A: [105254]
   Structural genomics target

Details for d1s4ka_

PDB Entry: 1s4k, 1.9 Å

PDB Description: Putative cytoplasmic protein from Salmonella typhimurium

PDB Compounds: (A:) putative cytoplasmic protein ydil

SCOPe Domain Sequences for d1s4ka_:

Sequence; same for both SEQRES and ATOM records:

>d1s4ka_ a.35.1.6 (A:) Putative cytoplasmic protein YdiL {Salmonella typhimurium [TaxId: 90371]}
ammnalelqalrrifdmtieectiyitqdnnsatwqrweagdipispeiiarlkemkarr
qrrinaivdkinnrignntmryfpdlssfqsiytegdfiewkiyqsvaaelfahdlerlc

Timeline for d1s4ka_:

• d1s4ka_ first appeared in SCOP 1.69
  
• d1s4ka_ appears in SCOP 1.75
  
• d1s4ka_ appears in SCOPe 2.02
  
• d1s4ka_ appears in the current release, SCOPe 2.08, called d1s4ka1