Lineage for d1s4ga_ (1s4g A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038384Fold g.64: Somatomedin B domain [90187] (1 superfamily)
    disulfide-rich
  4. 3038385Superfamily g.64.1: Somatomedin B domain [90188] (1 family) (S)
    automatically mapped to Pfam PF01033
  5. 3038386Family g.64.1.1: Somatomedin B domain [90189] (1 protein)
  6. 3038387Protein Vitronectin [90190] (1 species)
  7. 3038388Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries)
    Uniprot P04004 20-70
  8. 3038394Domain d1s4ga_: 1s4g A: [105253]
    complexed with oh

Details for d1s4ga_

PDB Entry: 1s4g (more details)

PDB Description: somatomedin-b domain of human plasma vitronectin.
PDB Compounds: (A:) Vitronectin

SCOPe Domain Sequences for d1s4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4ga_ g.64.1.1 (A:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]}
dqesckgrctegfnvdkkcqcdelcsyyqscctdytaeckpqvtrgdvftm

SCOPe Domain Coordinates for d1s4ga_:

Click to download the PDB-style file with coordinates for d1s4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1s4ga_: