Lineage for d1s4bp_ (1s4b P:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729182Family d.92.1.5: Neurolysin-like [55505] (4 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 729203Protein Neurolysin (endopeptidase 24.16, thimet oligopeptidase) [55506] (2 species)
    M3 family member; the thermolysin-like catalytic domain consists of residues 352-674
  7. 729204Species Human (Homo sapiens) [TaxId:9606] [111081] (1 PDB entry)
  8. 729205Domain d1s4bp_: 1s4b P: [105252]
    complexed with zn; mutant

Details for d1s4bp_

PDB Entry: 1s4b (more details), 2 Å

PDB Description: crystal structure of human thimet oligopeptidase.
PDB Compounds: (P:) Thimet oligopeptidase

SCOP Domain Sequences for d1s4bp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]}
lrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevtytvqrnild
fpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslrpeaaryle
rliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqelgglpedf
lnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensailkelvtlr
aqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravilelkraecer
rglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqellglafhh
eegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgclrqdgsrqi
aiaamvanftkptadapsllqhdevetyfhefghvmhqlcsqaefamfsgthverdfvea
psqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqa
lhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylwsevysmdmf
htrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllskgl

SCOP Domain Coordinates for d1s4bp_:

Click to download the PDB-style file with coordinates for d1s4bp_.
(The format of our PDB-style files is described here.)

Timeline for d1s4bp_: