SCOP 1.75: Domain d1s3zb_: 1s3z B:

Lineage for d1s3zb_ (1s3z B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)

6. Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (2 species)

7. Species Salmonella enteritidis [TaxId:149539] [111099] (3 PDB entries)
   Uniprot Q9R381

8. Domain d1s3zb_: 1s3z B: [105251]
   complexed with coa, ni, rio, so4

Details for d1s3zb_

PDB Entry: 1s3z, 2 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and Ribostamycin

PDB Compounds: (B:) aminoglycoside 6'-N-acetyltransferase

SCOP Domain Sequences for d1s3zb_:

Sequence; same for both SEQRES and ATOM records:

>d1s3zb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}
mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
tisqkvhqalgfeetervifyrkrc

Timeline for d1s3zb_:

• d1s3zb_ first appeared in SCOP 1.69
  
• d1s3zb_ appears in SCOP 1.73
  
• d1s3zb_ appears in SCOPe 2.01
  
• d1s3zb_ appears in the current release, SCOPe 2.08