Lineage for d1s3zb_ (1s3z B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731009Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (1 species)
  7. 731010Species Salmonella enteritidis [TaxId:592] [111099] (3 PDB entries)
  8. 731012Domain d1s3zb_: 1s3z B: [105251]
    complexed with coa, ni, rio, so4

Details for d1s3zb_

PDB Entry: 1s3z (more details), 2 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and Ribostamycin
PDB Compounds: (B:) aminoglycoside 6'-N-acetyltransferase

SCOP Domain Sequences for d1s3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3zb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 592]}
mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
tisqkvhqalgfeetervifyrkrc

SCOP Domain Coordinates for d1s3zb_:

Click to download the PDB-style file with coordinates for d1s3zb_.
(The format of our PDB-style files is described here.)

Timeline for d1s3zb_: