Lineage for d1s3zb_ (1s3z B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533236Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (2 species)
  7. 2533240Species Salmonella enteritidis [TaxId:149539] [111099] (3 PDB entries)
    Uniprot Q9R381
  8. 2533242Domain d1s3zb_: 1s3z B: [105251]
    Other proteins in same PDB: d1s3za2
    complexed with coa, ni, rio, so4

Details for d1s3zb_

PDB Entry: 1s3z (more details), 2 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and Ribostamycin
PDB Compounds: (B:) aminoglycoside 6'-N-acetyltransferase

SCOPe Domain Sequences for d1s3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3zb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}
mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
tisqkvhqalgfeetervifyrkrc

SCOPe Domain Coordinates for d1s3zb_:

Click to download the PDB-style file with coordinates for d1s3zb_.
(The format of our PDB-style files is described here.)

Timeline for d1s3zb_: