Lineage for d1s3za_ (1s3z A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509342Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509343Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 509344Family d.108.1.1: N-acetyl transferase, NAT [55730] (20 proteins)
  6. 509366Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (1 species)
  7. 509367Species Salmonella enteritidis [111099] (3 PDB entries)
  8. 509368Domain d1s3za_: 1s3z A: [105250]

Details for d1s3za_

PDB Entry: 1s3z (more details), 2 Å

PDB Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and Ribostamycin

SCOP Domain Sequences for d1s3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis}
shmdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfa
dasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtsp
entisqkvhqalgfeetervifyrkrc

SCOP Domain Coordinates for d1s3za_:

Click to download the PDB-style file with coordinates for d1s3za_.
(The format of our PDB-style files is described here.)

Timeline for d1s3za_: