Lineage for d1s3pa_ (1s3p A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319826Family a.39.1.4: Parvalbumin [47492] (3 protein domains)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2319832Protein Parvalbumin [47495] (9 species)
  7. 2319857Species Norway rat (Rattus norvegicus) [TaxId:10116] [158476] (6 PDB entries)
  8. 2319865Domain d1s3pa_: 1s3p A: [105249]
    complexed with ca, so4; mutant

Details for d1s3pa_

PDB Entry: 1s3p (more details), 2 Å

PDB Description: crystal structure of rat alpha-parvalbumin s55d/e59d mutant
PDB Compounds: (A:) parvalbumin alpha

SCOPe Domain Sequences for d1s3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3pa_ a.39.1.4 (A:) Parvalbumin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdkdgfide
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOPe Domain Coordinates for d1s3pa_:

Click to download the PDB-style file with coordinates for d1s3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1s3pa_: