SCOPe 2.08: Domain d1s3nb_: 1s3n B:

Lineage for d1s3nb_ (1s3n B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein Putative phosphodiesterase MJ0936 [111234] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [111235] (3 PDB entries)
   Uniprot Q58346

8. Domain d1s3nb_: 1s3n B: [105246]
   Structural genomics target
   complexed with mn

Details for d1s3nb_

PDB Entry: 1s3n, 2.5 Å

PDB Description: Structural and Functional Characterization of a Novel Archaeal Phosphodiesterase

PDB Compounds: (B:) Hypothetical protein MJ0936

SCOPe Domain Sequences for d1s3nb_:

Sequence; same for both SEQRES and ATOM records:

>d1s3nb_ d.159.1.7 (B:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

Timeline for d1s3nb_:

• d1s3nb_ first appeared in SCOP 1.69
  
• d1s3nb_ appears in SCOPe 2.07