SCOP 1.73: Domain d1s3na_: 1s3n A:

Lineage for d1s3na_ (1s3n A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (3 proteins)

6. Protein Putative phosphodiesterase MJ0936 [111234] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [111235] (4 PDB entries)

8. Domain d1s3na_: 1s3n A: [105245]

Details for d1s3na_

PDB Entry: 1s3n, 2.5 Å

PDB Description: Structural and Functional Characterization of a Novel Archaeal Phosphodiesterase

PDB Compounds: (A:) Hypothetical protein MJ0936

SCOP Domain Sequences for d1s3na_:

Sequence; same for both SEQRES and ATOM records:

>d1s3na_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

Timeline for d1s3na_:

• d1s3na_ first appeared in SCOP 1.69
  
• d1s3na_ appears in SCOP 1.71
  
• d1s3na_ appears in SCOP 1.75
  
• d1s3na_ appears in the current release, SCOPe 2.08