Lineage for d1s3ma_ (1s3m A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613398Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 613399Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam 00149
  5. 613494Family d.159.1.7: YfcE-like [111233] (2 proteins)
  6. 613501Protein Putative phosphodiesterase MJ0936 [111234] (1 species)
  7. 613502Species Methanococcus jannaschii [TaxId:2190] [111235] (3 PDB entries)
  8. 613505Domain d1s3ma_: 1s3m A: [105243]

Details for d1s3ma_

PDB Entry: 1s3m (more details), 2.5 Å

PDB Description: Structural and Functional Characterization of a Novel Archaeal Phosphodiesterase

SCOP Domain Sequences for d1s3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ma_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

SCOP Domain Coordinates for d1s3ma_:

Click to download the PDB-style file with coordinates for d1s3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1s3ma_: