Lineage for d1s3lb_ (1s3l B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513548Family d.159.1.7: YfcE-like [111233] (2 proteins)
  6. 513555Protein Putative phosphodiesterase MJ0936 [111234] (1 species)
  7. 513556Species Methanococcus jannaschii [TaxId:2190] [111235] (3 PDB entries)
  8. 513558Domain d1s3lb_: 1s3l B: [105242]
    Structural genomics target

Details for d1s3lb_

PDB Entry: 1s3l (more details), 2.4 Å

PDB Description: Structural and Functional Characterization of a Novel Archaeal Phosphodiesterase

SCOP Domain Sequences for d1s3lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3lb_ d.159.1.7 (B:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii}
mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnn
dgercklkewlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviygh
thervfeevddvlvinpgeccgyltgiptigildtekkeyreivl

SCOP Domain Coordinates for d1s3lb_:

Click to download the PDB-style file with coordinates for d1s3lb_.
(The format of our PDB-style files is described here.)

Timeline for d1s3lb_: