SCOP 1.71: Domain d1s3kh2: 1s3k H:120-219

Lineage for d1s3kh2 (1s3k H:120-219)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1s3kh2: 1s3k H:120-219 [105238]
   Other proteins in same PDB: d1s3kh1, d1s3kl1, d1s3kl2
   MQ NA P01857 # artificial chimera
   complexed with fuc, gal, gol, nag

Details for d1s3kh2

PDB Entry: 1s3k, 1.9 Å

PDB Description: Crystal Structure of a Humanized Fab (hu3S193) in Complex with the Lewis Y Tetrasaccharide

SCOP Domain Sequences for d1s3kh2:

Sequence, based on SEQRES records:

>d1s3kh2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1s3kh2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapgtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1s3kh2:

• d1s3kh2 first appeared in SCOP 1.69
  
• d1s3kh2 appears in SCOP 1.73
  
• d1s3kh2 appears in the current release, SCOPe 2.07