SCOPe 2.03: Domain d1s30a2: 1s30 A:148-191

Lineage for d1s30a2 (1s30 A:148-191)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubrerythrin, C-terminal domain [57811] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries)
   Uniprot P24931

8. Domain d1s30a2: 1s30 A:148-191 [105233]
   Other proteins in same PDB: d1s30a1
   complexed with fe, zn

Details for d1s30a2

PDB Entry: 1s30, 2.05 Å

PDB Description: X-ray crystal structure of Desulfovibrio vulgaris Rubrerythrin with displacement of iron by zinc at the diiron Site

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1s30a2:

Sequence; same for both SEQRES and ATOM records:

>d1s30a2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

Timeline for d1s30a2:

• d1s30a2 first appeared in SCOP 1.69
  
• d1s30a2 appears in SCOPe 2.02
  
• d1s30a2 appears in SCOPe 2.04
  
• d1s30a2 appears in the current release, SCOPe 2.08