| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
| Protein Rubrerythrin, C-terminal domain [57811] (2 species) |
| Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries) Uniprot P24931 |
| Domain d1s2za2: 1s2z A:148-191 [105231] Other proteins in same PDB: d1s2za1 complexed with fe, zn |
PDB Entry: 1s2z (more details), 1.75 Å
SCOPe Domain Sequences for d1s2za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2za2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw
Timeline for d1s2za2: