SCOP 1.69: Domain d1s2xa_: 1s2x A:

Lineage for d1s2xa_ (1s2x A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.47: STAT-like [47654] (4 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.3: Cag-Z [109839] (1 family)
   four-helical bundle without significant twist

5. Family a.47.3.1: Cag-Z [109840] (1 protein)

6. Protein Cag-Z [109841] (1 species)

7. Species Helicobacter pylori [TaxId:210] [109842] (1 PDB entry)

8. Domain d1s2xa_: 1s2x A: [105229]

Details for d1s2xa_

PDB Entry: 1s2x, 1.9 Å

PDB Description: crystal structure of cag-z from helicobacter pylori

SCOP Domain Sequences for d1s2xa_:

Sequence; same for both SEQRES and ATOM records:

>d1s2xa_ a.47.3.1 (A:) Cag-Z {Helicobacter pylori}
vdelgfneaerqkildsnsslmrnanevrdkfiqnyatslkdsndpqdflrrvqelrinm
qknfisfdayynylnnlvlasynrckqektfaestikneltlgefvaeisdnfnnftcde
varisdlvasylpreylppfidgnmmgvafqilgiddfgkklneivqdigtkyiilsknk

Timeline for d1s2xa_:

• d1s2xa_ is new in SCOP 1.69
  
• d1s2xa_ appears in SCOP 1.71
  
• d1s2xa_ appears in the current release, SCOPe 2.08, called d1s2xa1