| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.3: Cag-Z [109839] (1 family) ![]() four-helical bundle without significant twist automatically mapped to Pfam PF09053 |
| Family a.47.3.1: Cag-Z [109840] (1 protein) |
| Protein Cag-Z [109841] (1 species) |
| Species Helicobacter pylori [TaxId:210] [109842] (1 PDB entry) Uniprot Q9JMX9 |
| Domain d1s2xa1: 1s2x A:1-179 [105229] Other proteins in same PDB: d1s2xa2 complexed with ipa |
PDB Entry: 1s2x (more details), 1.9 Å
SCOPe Domain Sequences for d1s2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2xa1 a.47.3.1 (A:1-179) Cag-Z {Helicobacter pylori [TaxId: 210]}
delgfneaerqkildsnsslmrnanevrdkfiqnyatslkdsndpqdflrrvqelrinmq
knfisfdayynylnnlvlasynrckqektfaestikneltlgefvaeisdnfnnftcdev
arisdlvasylpreylppfidgnmmgvafqilgiddfgkklneivqdigtkyiilsknk
Timeline for d1s2xa1: