Lineage for d1s2xa1 (1s2x A:1-179)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997864Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 1997911Superfamily a.47.3: Cag-Z [109839] (1 family) (S)
    four-helical bundle without significant twist
    automatically mapped to Pfam PF09053
  5. 1997912Family a.47.3.1: Cag-Z [109840] (1 protein)
  6. 1997913Protein Cag-Z [109841] (1 species)
  7. 1997914Species Helicobacter pylori [TaxId:210] [109842] (1 PDB entry)
    Uniprot Q9JMX9
  8. 1997915Domain d1s2xa1: 1s2x A:1-179 [105229]
    Other proteins in same PDB: d1s2xa2
    complexed with ipa

Details for d1s2xa1

PDB Entry: 1s2x (more details), 1.9 Å

PDB Description: Crystal structure of Cag-Z from Helicobacter pylori
PDB Compounds: (A:) Cag-Z

SCOPe Domain Sequences for d1s2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2xa1 a.47.3.1 (A:1-179) Cag-Z {Helicobacter pylori [TaxId: 210]}
delgfneaerqkildsnsslmrnanevrdkfiqnyatslkdsndpqdflrrvqelrinmq
knfisfdayynylnnlvlasynrckqektfaestikneltlgefvaeisdnfnnftcdev
arisdlvasylpreylppfidgnmmgvafqilgiddfgkklneivqdigtkyiilsknk

SCOPe Domain Coordinates for d1s2xa1:

Click to download the PDB-style file with coordinates for d1s2xa1.
(The format of our PDB-style files is described here.)

Timeline for d1s2xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s2xa2