SCOPe 2.08: Domain d1s2xa1: 1s2x A:1-179

Lineage for d1s2xa1 (1s2x A:1-179)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.3: Cag-Z [109839] (1 family)
   four-helical bundle without significant twist
   automatically mapped to Pfam PF09053

5. Family a.47.3.1: Cag-Z [109840] (1 protein)

6. Protein Cag-Z [109841] (1 species)

7. Species Helicobacter pylori [TaxId:210] [109842] (1 PDB entry)
   Uniprot Q9JMX9

8. Domain d1s2xa1: 1s2x A:1-179 [105229]
   Other proteins in same PDB: d1s2xa2
   complexed with ipa

Details for d1s2xa1

PDB Entry: 1s2x, 1.9 Å

PDB Description: crystal structure of cag-z from helicobacter pylori

PDB Compounds: (A:) Cag-Z

SCOPe Domain Sequences for d1s2xa1:

Sequence; same for both SEQRES and ATOM records:

>d1s2xa1 a.47.3.1 (A:1-179) Cag-Z {Helicobacter pylori [TaxId: 210]}
delgfneaerqkildsnsslmrnanevrdkfiqnyatslkdsndpqdflrrvqelrinmq
knfisfdayynylnnlvlasynrckqektfaestikneltlgefvaeisdnfnnftcdev
arisdlvasylpreylppfidgnmmgvafqilgiddfgkklneivqdigtkyiilsknk

Timeline for d1s2xa1:

• d1s2xa1 first appeared in SCOP 1.69, called d1s2xa_
  
• d1s2xa1 appears in SCOPe 2.07