SCOPe 2.06: Domain d1s2jb1: 1s2j B:11-177

Lineage for d1s2jb1 (1s2j B:11-177)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein Peptidoglycan-recognition protein-SA (Cg11709) [111139] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [111140] (2 PDB entries)
   Uniprot Q9VYX7 37-203 ! Uniprot Q9VYX7

8. Domain d1s2jb1: 1s2j B:11-177 [105228]
   Other proteins in same PDB: d1s2ja2, d1s2jb2
   complexed with po4

Details for d1s2jb1

PDB Entry: 1s2j, 2.2 Å

PDB Description: Crystal structure of the Drosophila pattern-recognition receptor PGRP-SA

PDB Compounds: (B:) Peptidoglycan recognition protein SA CG11709-PA

SCOPe Domain Sequences for d1s2jb1:

Sequence; same for both SEQRES and ATOM records:

>d1s2jb1 d.118.1.1 (B:11-177) Peptidoglycan-recognition protein-SA (Cg11709) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnp

Timeline for d1s2jb1:

• d1s2jb1 first appeared in SCOP 1.69, called d1s2jb_
  
• d1s2jb1 was called d1s2jb_ in SCOPe 2.05
  
• d1s2jb1 appears in SCOPe 2.07
  
• d1s2jb1 appears in the current release, SCOPe 2.08