Lineage for d1s2jb_ (1s2j B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510337Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 510338Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family) (S)
  5. 510339Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (5 proteins)
    Family 2 zinc amidase;
  6. 510354Protein Peptidoglycan-recognition protein-SA (Cg11709) [111139] (1 species)
  7. 510355Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [111140] (2 PDB entries)
  8. 510359Domain d1s2jb_: 1s2j B: [105228]

Details for d1s2jb_

PDB Entry: 1s2j (more details), 2.2 Å

PDB Description: Crystal structure of the Drosophila pattern-recognition receptor PGRP-SA

SCOP Domain Sequences for d1s2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2jb_ d.118.1.1 (B:) Peptidoglycan-recognition protein-SA (Cg11709) {Fruit fly (Drosophila melanogaster)}
cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnph

SCOP Domain Coordinates for d1s2jb_:

Click to download the PDB-style file with coordinates for d1s2jb_.
(The format of our PDB-style files is described here.)

Timeline for d1s2jb_: