Lineage for d1s2ja_ (1s2j A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924236Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1924237Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1924238Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1924289Protein Peptidoglycan-recognition protein-SA (Cg11709) [111139] (1 species)
  7. 1924290Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [111140] (2 PDB entries)
    Uniprot Q9VYX7 37-203 ! Uniprot Q9VYX7
  8. 1924293Domain d1s2ja_: 1s2j A: [105227]
    complexed with po4

Details for d1s2ja_

PDB Entry: 1s2j (more details), 2.2 Å

PDB Description: Crystal structure of the Drosophila pattern-recognition receptor PGRP-SA
PDB Compounds: (A:) Peptidoglycan recognition protein SA CG11709-PA

SCOPe Domain Sequences for d1s2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ja_ d.118.1.1 (A:) Peptidoglycan-recognition protein-SA (Cg11709) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphh

SCOPe Domain Coordinates for d1s2ja_:

Click to download the PDB-style file with coordinates for d1s2ja_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ja_: