Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) |
Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins) the family sequences are very divergent |
Protein AvrPphF ORF1, chaperone of AvrPphF ORF2 [110792] (1 species) |
Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [110793] (1 PDB entry) Uniprot Q9K2L2 1-125 |
Domain d1s28d1: 1s28 D:3-130 [105226] Other proteins in same PDB: d1s28a2, d1s28b2, d1s28c2, d1s28d2 complexed with so4 |
PDB Entry: 1s28 (more details), 3 Å
SCOPe Domain Sequences for d1s28d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s28d1 d.198.1.1 (D:3-130) AvrPphF ORF1, chaperone of AvrPphF ORF2 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]} mknsfdrlidglakdygmpgfpekkhehevycfefkevsiriyqdkfkwvyflsdigvid nldsnacqsllrlnefnlrtpfftvglnekkdgvvhtripllnldnvemrrvfeallnls gevkktfg
Timeline for d1s28d1: