SCOPe 2.08: Domain d1s28d1: 1s28 D:3-130

Lineage for d1s28d1 (1s28 D:3-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
   the family sequences are very divergent

6. Protein AvrPphF ORF1, chaperone of AvrPphF ORF2 [110792] (1 species)

7. Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [110793] (1 PDB entry)
   Uniprot Q9K2L2 1-125

8. Domain d1s28d1: 1s28 D:3-130 [105226]
   Other proteins in same PDB: d1s28a2, d1s28b2, d1s28c2, d1s28d2
   complexed with so4

Details for d1s28d1

PDB Entry: 1s28, 3 Å

PDB Description: crystal structure of avrpphf orf1, the chaperone for the type iii effector avrpphf orf2 from p. syringae

PDB Compounds: (D:) orf1

SCOPe Domain Sequences for d1s28d1:

Sequence; same for both SEQRES and ATOM records:

>d1s28d1 d.198.1.1 (D:3-130) AvrPphF ORF1, chaperone of AvrPphF ORF2 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
mknsfdrlidglakdygmpgfpekkhehevycfefkevsiriyqdkfkwvyflsdigvid
nldsnacqsllrlnefnlrtpfftvglnekkdgvvhtripllnldnvemrrvfeallnls
gevkktfg

Timeline for d1s28d1:

• d1s28d1 first appeared in SCOP 1.69, called d1s28d_
  
• d1s28d1 appears in SCOPe 2.07