Lineage for d1s28b1 (1s28 B:3-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611807Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 2611808Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 2611809Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
    the family sequences are very divergent
  6. 2611810Protein AvrPphF ORF1, chaperone of AvrPphF ORF2 [110792] (1 species)
  7. 2611811Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [110793] (1 PDB entry)
    Uniprot Q9K2L2 1-125
  8. 2611813Domain d1s28b1: 1s28 B:3-130 [105224]
    Other proteins in same PDB: d1s28a2, d1s28b2, d1s28c2, d1s28d2
    complexed with so4

Details for d1s28b1

PDB Entry: 1s28 (more details), 3 Å

PDB Description: crystal structure of avrpphf orf1, the chaperone for the type iii effector avrpphf orf2 from p. syringae
PDB Compounds: (B:) orf1

SCOPe Domain Sequences for d1s28b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s28b1 d.198.1.1 (B:3-130) AvrPphF ORF1, chaperone of AvrPphF ORF2 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
mknsfdrlidglakdygmpgfpekkhehevycfefkevsiriyqdkfkwvyflsdigvid
nldsnacqsllrlnefnlrtpfftvglnekkdgvvhtripllnldnvemrrvfeallnls
gevkktfg

SCOPe Domain Coordinates for d1s28b1:

Click to download the PDB-style file with coordinates for d1s28b1.
(The format of our PDB-style files is described here.)

Timeline for d1s28b1: