Lineage for d1s21a_ (1s21 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606646Family d.166.1.4: AvrPphF ORF2, a type III effector [111257] (1 protein)
    shares the common structural core with other families; unknown function
    automatically mapped to Pfam PF09143
  6. 2606647Protein AvrPphF ORF2, a type III effector [111258] (1 species)
  7. 2606648Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [111259] (1 PDB entry)
    Uniprot Q9K2L5 29-204
  8. 2606649Domain d1s21a_: 1s21 A: [105222]

Details for d1s21a_

PDB Entry: 1s21 (more details), 2 Å

PDB Description: crystal structure of avrpphf orf2, a type iii effector from p. syringae
PDB Compounds: (A:) orf2

SCOPe Domain Sequences for d1s21a_:

Sequence, based on SEQRES records: (download)

>d1s21a_ d.166.1.4 (A:) AvrPphF ORF2, a type III effector {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
psrfvgqytltsihqlsseerenfldahdpmrvydlnsetsvyrttqreyvrngyatgnp
nsgaiialheelqespyaqhigarpdqadayrprtahvsslntpslnvmagqgalsalrg
yagsdhvttemrlgdfldqggkvysdtsamsaggdsvealivtlpkgrkvpvnild

Sequence, based on observed residues (ATOM records): (download)

>d1s21a_ d.166.1.4 (A:) AvrPphF ORF2, a type III effector {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
psrfvgqytltsihqlsseerenfldahdpmrvydlnsetsvyrttqreyvrngyatgnp
nsgaiialheelqespyaqhigarpdqadayrprtahvsslntpslnvmagqgalsalhv
ttemrlgdfldqggkvysdtsggdsvealivtlpkgrkvpvnild

SCOPe Domain Coordinates for d1s21a_:

Click to download the PDB-style file with coordinates for d1s21a_.
(The format of our PDB-style files is described here.)

Timeline for d1s21a_: