SCOPe 2.05: Domain d1s1za_: 1s1z A:

Lineage for d1s1za_ (1s1z A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (3 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (62 PDB entries)
   Uniprot P16113

8. Domain d1s1za_: 1s1z A: [105221]
   complexed with hc4; mutant

Details for d1s1za_

PDB Entry: 1s1z, 1.6 Å

PDB Description: photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 to 500 nanoseconds

PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1s1za_:

Sequence; same for both SEQRES and ATOM records:

>d1s1za_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1s1za_:

• d1s1za_ first appeared in SCOP 1.69
  
• d1s1za_ appears in SCOPe 2.04
  
• d1s1za_ appears in SCOPe 2.06
  
• d1s1za_ appears in the current release, SCOPe 2.08