Lineage for d1s1ya_ (1s1y A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731664Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 731665Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 731666Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 731667Species Ectothiorhodospira halophila [TaxId:17] [55788] (40 PDB entries)
  8. 731685Domain d1s1ya_: 1s1y A: [105220]
    complexed with hc4; mutant

Details for d1s1ya_

PDB Entry: 1s1y (more details), 1.6 Å

PDB Description: photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 microseconds to 3 milliseconds
PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d1s1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ya_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d1s1ya_:

Click to download the PDB-style file with coordinates for d1s1ya_.
(The format of our PDB-style files is described here.)

Timeline for d1s1ya_: