![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
![]() | Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries) |
![]() | Domain d1s1xa1: 1s1x A:430-539 [105217] Other proteins in same PDB: d1s1xa2, d1s1xb1 complexed with nvp; mutant |
PDB Entry: 1s1x (more details), 2.8 Å
SCOP Domain Sequences for d1s1xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1xa1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
Timeline for d1s1xa1: