Lineage for d1s1ua2 (1s1u A:4-429)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618313Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 618314Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (83 PDB entries)
  8. 618424Domain d1s1ua2: 1s1u A:4-429 [105209]
    Other proteins in same PDB: d1s1ua1

Details for d1s1ua2

PDB Entry: 1s1u (more details), 3 Å

PDB Description: Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with nevirapine
PDB Compounds: (A:)

SCOP Domain Sequences for d1s1ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ua2 e.8.1.2 (A:4-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
kkkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
mddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
ivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelel
aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
klwyql

SCOP Domain Coordinates for d1s1ua2:

Click to download the PDB-style file with coordinates for d1s1ua2.
(The format of our PDB-style files is described here.)

Timeline for d1s1ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1ua1
View in 3D
Domains from other chains:
(mouse over for more information)
d1s1ub1