Lineage for d1s1ua1 (1s1u A:430-539)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488415Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 488428Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 488429Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries)
  8. 488480Domain d1s1ua1: 1s1u A:430-539 [105208]
    Other proteins in same PDB: d1s1ua2, d1s1ub1

Details for d1s1ua1

PDB Entry: 1s1u (more details), 3 Å

PDB Description: crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine

SCOP Domain Sequences for d1s1ua1:

Sequence, based on SEQRES records: (download)

>d1s1ua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Sequence, based on observed residues (ATOM records): (download)

>d1s1ua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah

SCOP Domain Coordinates for d1s1ua1:

Click to download the PDB-style file with coordinates for d1s1ua1.
(The format of our PDB-style files is described here.)

Timeline for d1s1ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s1ua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1s1ub1